PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024550001
Common NameGSBRNA2T00024550001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 189aa    MW: 21042.9 Da    PI: 6.9246
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024550001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.27e-4481071100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+Cak+C++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q+ ql
  GSBRNA2T00024550001   8 PCASCKLLRRRCAKECIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVTQL 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  GSBRNA2T00024550001  98 QMQLAVAQTE 107
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6817108IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MRGPGSSPCA SCKLLRRRCA KECIFAPYFP PDDPHKFAIV HKVFGASNVS KMLQELPVHQ  60
RADAVNSLVF EANARVRDPV YGCVGAISYL QNQVTQLQMQ LAVAQTEILC IQMQHEPALQ  120
SHHEVFELDQ DDKAHLLHSN NNSINNCNNN YNLAYAMSSG QLNSNFASPS SIIQMQMQDP  180
LKQESLWT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024550001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325590.0AC232559.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH038M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013733966.11e-138PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-107LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A078GFX31e-140A0A078GFX3_BRANA; BnaC03g16640D protein
TrEMBLA0A0D3B4561e-140A0A0D3B456_BRAOL; Uncharacterized protein
STRINGBra022780.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-108LBD family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]